GRID2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GRID2 Polyclonal antibody, PBS Only (21727-1-PBS)

• 

  WB analysis using 21727-1-AP (same clone as 21727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21727-1-AP (GRID2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21727-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21727-1-AP (same clone as 21727-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21727-1-AP (GRID2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 21727-1-AP (same clone as 21727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21727-1-AP (GRID2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21727-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 21727-1-AP (same clone as 21727-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21727-1-AP (GRID2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21727-1-PBS in a different storage buffer formulation.

GRID2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21727-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

GluR delta 2 subunit, GLURD2

---

Product Information

21727-1-PBS targets GRID2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16391

  Product name: Recombinant human GRID2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-358 aa of BC099652

  Sequence: SANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRK

• Full Name: glutamate receptor, ionotropic, delta 2
• Calculated Molecular Weight: 1007 aa, 113 kDa
• Observed Molecular Weight: 113 kDa
• GenBank Accession Number: BC099652
• Gene Symbol: GRID2
• Gene ID (NCBI): 2895
• RRID: AB_3742053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43424
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The GRID2 gene provides instructions for making a protein called the glutamate receptor ionotropic, delta-2 subunit (GluD2) . While it belongs to the family of ionotropic glutamate receptors, which are proteins that respond to the neurotransmitter glutamate by opening an ion channel, GluD2 is unique. It is often referred to as an "orphan" receptor because it does not bind glutamate or function as a typical ion channel. Instead, its primary roles are structural and organizational, critical for the development, maintenance, and function of specific synapses in the brain.