GRINA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GRINA Polyclonal antibody, PBS Only (20851-1-PBS)

• 

  WB analysis using 20851-1-AP (same clone as 20851-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20851-1-AP (GRINA antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20851-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 20851-1-AP (same clone as 20851-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 20851-1-AP (GRINA antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20851-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 20851-1-AP (same clone as 20851-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 20851-1-AP (GRINA antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20851-1-PBS in a different storage buffer formulation.

GRINA Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20851-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Glutamate [NMDA] receptor-associated protein 1, HNRGW, LFG1, Protein lifeguard 1, Putative MAPK-activating protein PM02

---

Product Information

20851-1-PBS targets GRINA in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14716

  Product name: Recombinant human GRINA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC041788

  Sequence: MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGYPQGPYPQNPFPPNPYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLT

• Full Name: glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding)
• Calculated Molecular Weight: 371 aa, 41 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC041788
• Gene Symbol: GRINA
• Gene ID (NCBI): 2907
• RRID: AB_3742005
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z429
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glutamate Receptor Ionotropic NMDA-Associated Protein 1 (GRINA, also known as TMBIM3) is a transmembrane protein involved in calcium homeostasis and cell survival. It plays a crucial role in regulating intracellular calcium levels, which are essential for processes such as cell survival, neurotransmitter release, and apoptosis (PMID: 32124700). GRINA also involves vesicle transport and sorting, particularly in secretory cells like neurons and mammary glands (PMID: 31426446). Additionally, GRINA has been implicated in regulating aerobic glycolysis and tumor progression in gastric cancer (PMID: 30541591).