GRP75 Monoclonal antibody, PBS Only

• 

  WB analysis using 67563-1-Ig (same clone as 67563-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67563-1-Ig (GRP75 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67563-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67563-1-Ig (same clone as 67563-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67563-1-Ig (GRP75 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67563-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67563-1-Ig (same clone as 67563-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67563-1-Ig (GRP75 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67563-1-PBS in a different storage buffer formulation.

GRP75 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67563-1-PBS

Clone No.2B12F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

HSPA9, 2B12F2, 75 kDa glucose-regulated protein, CSA, GRP-75

---

Product Information

67563-1-PBS targets GRP75 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7125

  Product name: Recombinant human GRP75 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 331-679 aa of BC000478

  Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

• Full Name: heat shock 70kDa protein 9 (mortalin)
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC000478
• Gene Symbol: GRP75
• Gene ID (NCBI): 3313
• RRID: AB_2882777
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P38646
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. (PMID: 21640711, 22920904)