Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, HEK-293 cells, MCF-7 cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells, NIH/3T3 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67563-1-Ig targets GRP75 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7125 Product name: Recombinant human GRP75 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 331-667 aa of BC000478 Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT Predict reactive species |
| Full Name | heat shock 70kDa protein 9 (mortalin) |
| Calculated Molecular Weight | 74 kDa |
| Observed Molecular Weight | 75 kDa |
| GenBank Accession Number | BC000478 |
| Gene Symbol | GRP75 |
| Gene ID (NCBI) | 3313 |
| RRID | AB_2882777 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P38646 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. (PMID: 21640711, 229209024)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GRP75 antibody 67563-1-Ig | Download protocol |
| WB protocol for GRP75 antibody 67563-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GRP75 Monoclonal antibody (2B12F2), catalog number 67563-1-Ig, has a total of 3 citations. These appear in Advanced Science, Journal of Ethnopharmacology, and Scientific Reports. The research fields span mitochondrial function in Parkinson's disease, ethanol-induced gastric mucosal injury involving apoptosis and calcium signaling, and disulfiram-induced protein insolubility in the mitochondrial matrix. All cited applications were Western blot.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Massage-Mimicking Nanosheets Mechanically Reorganize Inter-organelle Contacts to Restore Mitochondrial Functions in Parkinson's Disease | ||
J Ethnopharmacol Dan-Shen-Yin against ethanol-induced chronic gastric mucosal injury in rats by inhibiting apoptosis via IP3R-controlled calcium release | ||
Sci Rep Imaging phenotype reveals that disulfirams induce protein insolubility in the mitochondrial matrix |
Reviews
What customers say
One reviewer (Lana Yablonska) gave this product a 5-star rating after using it for Western Blot on mouse embryonic stem cells at a 1:5000 dilution. She reported clear results across whole cell lysate and mitochondrial fraction samples, and shared her full protocol details including transfer conditions, blocking buffer, and secondary antibody dilution (IRDye 800CW Goat anti-Rabbit at 1:15000). Overall, the feedback is positive with no issues noted.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lana (Verified Customer) (07-15-2020) | SDS-PAGE: 20 ug/ul RIPA protein lysate. 4-12% Bis-tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:5000.Secondary Ab: IRDye 800CW Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – whole cell lysate, 2 – mitochondrial fraction lysate, 3 – protein ladder.
![]() |






