GRP75 Monoclonal antibody

GRP75 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67563-1-Ig
Clone No.2B12F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

HSPA9, 2B12F2, 75 kDa glucose-regulated protein, CSA, GRP-75

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HEK-293 cells, MCF-7 cells, Jurkat cells, K-562 cells, HSC-T6 cells, 4T1 cells, NIH/3T3 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

67563-1-Ig targets GRP75 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7125

Product name: Recombinant human GRP75 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 331-679 aa of BC000478

Sequence: YLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

Predict reactive species
Full Name heat shock 70kDa protein 9 (mortalin)
Calculated Molecular Weight 74 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC000478
Gene Symbol GRP75
Gene ID (NCBI) 3313
RRIDAB_2882777
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP38646
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRP75 (also known as mortalin, HSPA9 or mt-Hsp70) is a constitutively expressed member of the HSPA (HSP70) family of heat-shock proteins. It is located in the mitochondrial matrix and anti-GRP75 is commonly used as the marker for mitochondria. It has been reported that GRP75 is enriched in cancer cells and contributes to carcinogenesis. In addition, decreased expression level of GRP75 has been found in neurodegenerative disorders like Parkinson's disease. (PMID: 21640711, 229209024)

Protocols

Product Specific Protocols
IHC protocol for GRP75 antibody 67563-1-IgDownload protocol
WB protocol for GRP75 antibody 67563-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Adv Sci (Weinh)

Massage-Mimicking Nanosheets Mechanically Reorganize Inter-organelle Contacts to Restore Mitochondrial Functions in Parkinson's Disease

Authors - Tianqi Li
rat,humanWB

J Ethnopharmacol

Dan-Shen-Yin against ethanol-induced chronic gastric mucosal injury in rats by inhibiting apoptosis via IP3R-controlled calcium release

Authors - Zhirong Zhou

Sci Rep

Imaging phenotype reveals that disulfirams induce protein insolubility in the mitochondrial matrix

Authors - Ken Ohno

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lana (Verified Customer) (07-15-2020)

SDS-PAGE: 20 ug/ul RIPA protein lysate. 4-12% Bis-tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:5000.Secondary Ab: IRDye 800CW Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – whole cell lysate, 2 – mitochondrial fraction lysate, 3 – protein ladder.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Mouse embryonic stem cells
GRP75 Antibody Western Blot validation (1:5000 dilution) in Mouse embryonic stem cells (Cat no:67563-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...