GRPEL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GRPEL2 Polyclonal antibody (17751-1-AP)

GRPEL2 Polyclonal Antibody for WB, ELISA

Cat No. 17751-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

Mt-GrpE#2

• 

  WB analysis of mouse liver using 17751-1-AP

  Mitochondrial proteins from mouse liver tissue were subjected to SDS PAGE followed by western blot with 17751-1-AP (GRPEL2 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GRPEL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17751-1-AP targets GRPEL2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12018

  Product name: Recombinant human GRPEL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC070090

  Sequence: MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

• Full Name: GrpE-like 2, mitochondrial (E. coli)
• Calculated Molecular Weight: 225 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC070090
• Gene Symbol: GRPEL2
• Gene ID (NCBI): 134266
• RRID: AB_2878432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAA5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GRPEL2 Polyclonal antibody (Cat# 17751-1-AP) has 3 citations. These appear in Molecular Cell, American Journal of Cancer Research, and bioRxiv. The research fields span mitochondrial protein import proteomics, the oncogenic role of GRPEL2 in hepatocellular carcinoma (HCC) development, and context-dependent interactors regulating TDP-43 dysfunction in ALS/FTLD.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery; Authors - Jasmin Adriana Schafer
human	WB	Am J Cancer Res; Experimental and clinical evidence suggests that GRPEL2 plays an oncogenic role in HCC development.; Authors - Ming-Chun Lai
human	IHC,IF	bioRxiv; Context-dependent Interactors Regulate TDP-43 Dysfunction in ALS/FTLD; Authors - Longxin Xie