GRPEL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GRPEL2 Polyclonal antibody, PBS Only (17751-1-PBS)

• 

  WB analysis of mouse liver using 17751-1-AP (same clone as 17751-1-PBS)

  Mitochondrial proteins from mouse liver tissue were subjected to SDS PAGE followed by western blot with 17751-1-AP (GRPEL2 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17751-1-PBS in a different storage buffer formulation.

GRPEL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17751-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17751-1-PBS targets GRPEL2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12018

  Product name: Recombinant human GRPEL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC070090

  Sequence: MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

• Full Name: GrpE-like 2, mitochondrial (E. coli)
• Calculated Molecular Weight: 225 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC070090
• Gene Symbol: GRPEL2
• Gene ID (NCBI): 134266
• RRID: AB_2878432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAA5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.