CoraLite®594-conjugated GSK3B Monoclonal antibody

GSK3B Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67329
Clone No.2E9E4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

GSK3 beta, GSK-3 beta, GSK 3 beta, EC:2.7.11.26, EC:2.7.11.1

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67329 targets GSK3B in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17320

Product name: Recombinant human GSK3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 355-433 aa of BC000251

Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Predict reactive species
Full Name glycogen synthase kinase 3 beta
Calculated Molecular Weight 433 aa, 48 kDa
Observed Molecular Weight 46-48 kDa
GenBank Accession NumberBC000251
Gene Symbol GSK3B
Gene ID (NCBI) 2932
RRIDAB_2920114
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49841
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase .GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.In skeletal muscle, it contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Researches showed that the crystal structure of human GSK3B, expressed in insect cells, at 2.8-angstrom resolution .

Protocols

Product Specific Protocols
IF protocol for CL594 GSK3B antibody CL594-67329Download protocol
FC protocol for CL594 GSK3B antibody CL594-67329Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...