Use Able AI chat for product recommendations

CoraLite® Plus 647-conjugated GSK3B Monoclonal antibody

GSK3B Monoclonal Antibody for FC (Intra)

Cat No. CL647-67329
Clone No.2E9E4

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

FC (Intra)

GSK3 beta, 2E9E4, EC:2.7.11.1, EC:2.7.11.26, GSK 3 beta

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-67329 targets GSK3B in FC (Intra) applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17320

Product name: Recombinant human GSK3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 355-433 aa of BC000251

Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

Predict reactive species
Full Name glycogen synthase kinase 3 beta
Calculated Molecular Weight 433 aa, 48 kDa
Observed Molecular Weight 46-48 kDa
GenBank Accession NumberBC000251
Gene Symbol GSK3B
Gene ID (NCBI) 2932
RRIDAB_2935077
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49841
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase .GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.In skeletal muscle, it contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Researches showed that the crystal structure of human GSK3B, expressed in insect cells, at 2.8-angstrom resolution .

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 GSK3B antibody CL647-67329Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...