GSTA4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85954-2-RR (same clone as 85954-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85954-2-RR (GSTA4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85954-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 85954-2-RR (same clone as 85954-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using GSTA4 antibody (85954-2-RR, Clone: 250352E2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85954-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 85954-2-RR (same clone as 85954-2-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HEK-293 cells using GSTA4 antibody (85954-2-RR, Clone: 250352E2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85954-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85954-2-RR

  Biolayer interferometry (BLl) kinetic assays of 85954-2-RR against Human GSTA4 were performed. The affinity constant is 0.489 nM.

GSTA4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85954-2-PBS

Clone No.250352E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:2.5.1.18, Glutathione S transferase A4, Glutathione S transferase A4 4, Glutathione S-transferase A4, Glutathione S-transferase A4-4

---

Product Information

85954-2-PBS targets GSTA4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11028

  Product name: Recombinant human GSTA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-222 aa of BC015523

  Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

• Full Name: glutathione S-transferase alpha 4
• Calculated Molecular Weight: 222 aa, 27 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC015523
• Gene Symbol: GSTA4
• Gene ID (NCBI): 2941
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15217
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GSTA4 (Glutathione S-Transferase Alpha 4) is an enzyme that plays a key role in detoxification and antioxidant defense. Its structure includes a GSH-binding site and a hydrophobic substrate-binding domain, functioning as a dimer. Dysregulation of GSTA4 is linked to diseases like cancer, neurodegeneration, and diabetes.