GSTCD Polyclonal antibody

• 

  WB analysis using 17502-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17502-1-AP (GSTCD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 17502-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 17502-1-AP (GSTCD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 17502-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17502-1-AP (GSTCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 17502-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 17502-1-AP (GSTCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 17502-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 17502-1-AP (GSTCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 17502-1-AP

  Immunofluorescent analysis of A549 cells using 17502-1-AP (GSTCD antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

GSTCD Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17502-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

GSTCD

---

Tested Applications

• Positive WB detected in: A431 cells, L02 cells, mouse kidney tissue, mouse liver tissue
• Positive IHC detected in: human liver tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

17502-1-AP targets GSTCD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11690

  Product name: Recombinant human GSTCD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 283-632 aa of BC032942

  Sequence: FTLADIVLLPCIHHFLVIISRKFSEKLVEFPLLASWYQRIQEVPGVKTASKCGIQFLHLPKLLTTSTEQHPNLCEVPGVEEQSDPLFIGGPRPTMAKLMEKGIEVMFSPHPCPTWTLDWNVLPAAVSPKEGKMSSDRALRKQQQLNNLVYVVTNQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGVALHACGVATDMVIEHCIKTRASFVTCPCCYGFIQNTSKFNFPKSEQFKKTLSYKEHMILCRFADQTAVQLPPQRRLIGKQCMCLVDLDRARAAEECGYSVQVISMEPESCSPKNNMIVGVPI

• Full Name: glutathione S-transferase, C-terminal domain containing
• Calculated Molecular Weight: 632 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC032942
• Gene Symbol: GSTCD
• Gene ID (NCBI): 79807
• RRID: AB_2115908
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutathione S-transferase, C-terminal domain-containing protein (GSTCD) is widely expressed in cell types relevant to airway function, including airway smooth muscle cells and epithelial cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Respir Res; Defining a role for lung function associated gene GSTCD in cell homeostasis.; Authors - Amanda P Henry ; KD Validated
mouse	IHC	PLoS One; Exposure to lipopolysaccharide (LPS) reduces contractile response of small airways from GSTCD-/- mice.; Authors - Bo Liu