GSTCD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSTCD Polyclonal antibody (17502-1-AP)

• Featured Product
• KD/KO Validated

GSTCD Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 17502-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

GSTCD

• 

  WB analysis using 17502-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17502-1-AP (GSTCD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 17502-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 17502-1-AP (GSTCD antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17502-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17502-1-AP (GSTCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 17502-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 17502-1-AP (GSTCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 17502-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 17502-1-AP (GSTCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 17502-1-AP

  Immunofluorescent analysis of A549 cells using 17502-1-AP (GSTCD antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSTCD in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, L02 cells, mouse kidney tissue, mouse liver tissue
• Positive IHC detected in: human liver tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17502-1-AP targets GSTCD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11690

  Product name: Recombinant human GSTCD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 283-632 aa of BC032942

  Sequence: FTLADIVLLPCIHHFLVIISRKFSEKLVEFPLLASWYQRIQEVPGVKTASKCGIQFLHLPKLLTTSTEQHPNLCEVPGVEEQSDPLFIGGPRPTMAKLMEKGIEVMFSPHPCPTWTLDWNVLPAAVSPKEGKMSSDRALRKQQQLNNLVYVVTNQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGVALHACGVATDMVIEHCIKTRASFVTCPCCYGFIQNTSKFNFPKSEQFKKTLSYKEHMILCRFADQTAVQLPPQRRLIGKQCMCLVDLDRARAAEECGYSVQVISMEPESCSPKNNMIVGVPI

• Full Name: glutathione S-transferase, C-terminal domain containing
• Calculated Molecular Weight: 632 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC032942
• Gene Symbol: GSTCD
• Gene ID (NCBI): 79807
• RRID: AB_2115908
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutathione S-transferase, C-terminal domain-containing protein (GSTCD) is widely expressed in cell types relevant to airway function, including airway smooth muscle cells and epithelial cells.

Publications

What published studies show

Anti-GSTCD (Cat# 17502-1-AP) has 2 total citations. They appear in Respiratory Research (IF 5.7) and PLoS One (IF 2.8). The research fields cover lung function and cell homeostasis related to the GSTCD gene (human, WB), and LPS-induced effects on small airway contractility in GSTCD knockout mice (mouse, IHC).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Respir Res; Defining a role for lung function associated gene GSTCD in cell homeostasis.; Authors - Amanda P Henry ; KD Validated
mouse	IHC	PLoS One; Exposure to lipopolysaccharide (LPS) reduces contractile response of small airways from GSTCD-/- mice.; Authors - Bo Liu