GSTP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66715-1-Ig (same clone as 66715-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66715-1-Ig (GSTP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66715-1-Ig (same clone as 66715-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66715-1-Ig (GSTP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66715-1-Ig (same clone as 66715-1-PBS)

  WB result of GSTP1 antibody (66715-1-Ig; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSTP1 transfected HeLa cells. This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 66715-1-Ig (same clone as 66715-1-PBS)

  IP result of anti-GSTP1 (IP:66715-1-Ig, 4ug; Detection:66715-1-Ig 1:4000) with HeLa cells lysate 1640 ug. This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66715-1-Ig (GSTP1 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66715-1-Ig (GSTP1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66715-1-Ig (GSTP1 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66715-1-Ig (GSTP1 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 66715-1-Ig (GSTP1 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66715-1-Ig (GSTP1 antibody) at dilution of 1:2000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66715-1-Ig (GSTP1 antibody) at dilution of 1:2000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using GSTP1 antibody (66715-1-Ig, Clone: 2D4A6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66715-1-Ig (same clone as 66715-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GSTP1 antibody (66715-1-Ig, Clone: 2D4A6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66715-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GSTP1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 66715-1-PBS

Clone No.2D4A6

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

2D4A6, EC:2.5.1.18, FAEES3, Glutathione S-transferase P, GST3

---

Product Information

66715-1-PBS targets GSTP1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8880

  Product name: Recombinant human GSTP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-210 aa of BC010915

  Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

• Full Name: glutathione S-transferase pi 1
• Calculated Molecular Weight: 210 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC010915
• Gene Symbol: GSTP1
• Gene ID (NCBI): 2950
• RRID: AB_2882066
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P09211
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.