GSTT1 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GSTT1 Monoclonal antibody, PBS Only (67645-1-PBS)

GSTT1 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67645-1-PBS Copied!

Clone No. 1A4C11

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

EC:2.5.1.18, Glutathione S-transferase theta-1, Glutathione transferase T1 1, Glutathione transferase T1-1, GST class theta 1

• 

  WB analysis using 67645-1-Ig (same clone as 67645-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67645-1-Ig (GSTT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67645-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig liver using 67645-1-Ig (same clone as 67645-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67645-1-Ig (GSTT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67645-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 67645-1-Ig (same clone as 67645-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67645-1-Ig (GSTT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67645-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 67645-1-Ig (same clone as 67645-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67645-1-Ig (GSTT1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67645-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 67645-1-Ig (same clone as 67645-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67645-1-Ig (GSTT1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67645-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse liver using 67645-1-Ig (same clone as 67645-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using GSTT1 antibody (67645-1-Ig, Clone: 1A4C11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67645-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse liver using 67645-1-Ig (same clone as 67645-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using GSTT1 antibody (67645-1-Ig, Clone: 1A4C11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67645-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSTT1 in ?

Chat with Able

---

Product Information

67645-1-PBS targets GSTT1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8573

  Product name: Recombinant human GSTT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-240 aa of BC007065

  Sequence: MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

• Full Name: glutathione S-transferase theta 1
• Calculated Molecular Weight: 240 aa, 27 kDa
• Observed Molecular Weight: 28 kDa, 30 kDa
• GenBank Accession Number: BC007065
• Gene Symbol: GSTT1
• Gene ID (NCBI): 2952
• RRID: AB_2882845
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30711
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GSTT1 belongs to the GST superfamily and Theta family. It is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. GSTT1 acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. It displays glutathione peroxidase activity with cumene hydroperoxide. GSTM1 and GSTT1 has been suggested as a risk factor in various cancers. GSTT1 is important in the detoxification of unidentified xenobiotics in the large intestine.