GSTT1 Monoclonal antibody

GSTT1 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 67645-1-Ig
Clone No.1A4C11

Host / Isotype

Mouse / IgG2b

Reactivity

Human, pig, mouse

Applications

WB, IHC, IF-P, ELISA

Glutathione transferase T1 1, GST class theta 1, GSTT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig lung tissue, pig liver tissue, K-562 cells, rat liver tissue, mouse brain tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67645-1-Ig targets GSTT1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, pig, mouse samples.

Tested Reactivity Human, pig, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8573

Product name: Recombinant human GSTT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-240 aa of BC007065

Sequence: MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Predict reactive species
Full Name glutathione S-transferase theta 1
Calculated Molecular Weight 240 aa, 27 kDa
Observed Molecular Weight 28 kDa, 30 kDa
GenBank Accession NumberBC007065
Gene Symbol GSTT1
Gene ID (NCBI) 2952
RRIDAB_2882845
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30711
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSTT1 belongs to the GST superfamily and Theta family. It is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. GSTT1 acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. It displays glutathione peroxidase activity with cumene hydroperoxide. GSTM1 and GSTT1 has been suggested as a risk factor in various cancers. GSTT1 is important in the detoxification of unidentified xenobiotics in the large intestine.

Protocols

Product Specific Protocols
IF protocol for GSTT1 antibody 67645-1-IgDownload protocol
IHC protocol for GSTT1 antibody 67645-1-IgDownload protocol
WB protocol for GSTT1 antibody 67645-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...