GSTT2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GSTT2B Polyclonal antibody, PBS Only (17622-1-PBS)

• 

  WB analysis using 17622-1-AP (same clone as 17622-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17622-1-AP (GSTT2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17622-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 17622-1-AP (same clone as 17622-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 17622-1-AP (GSTT2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17622-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 17622-1-AP (same clone as 17622-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 17622-1-AP (GSTT2B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17622-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 17622-1-AP (same clone as 17622-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using GSTT2B antibody (17622-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17622-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GSTT2B Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 17622-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

17622-1-PBS targets GSTT2B in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11828

  Product name: Recombinant human GSTT2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-244 aa of BC071700

  Sequence: MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP

• Full Name: glutathione S-transferase theta 2B (gene/pseudogene)
• Calculated Molecular Weight: 244 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC071700
• Gene Symbol: GSTT2B
• Gene ID (NCBI): 653689
• RRID: AB_2116359
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0CG30
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.