GTDC1 Polyclonal antibody

• 

  IHC staining of mouse testis using 16666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 16666-1-AP (GTDC1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver using 16666-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16666-1-AP (GTDC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9).

• 

  IHC staining of human testis using 16666-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 16666-1-AP (GTDC1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 16666-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16666-1-AP (GTDC1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human spleen using 16666-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16666-1-AP (GTDC1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human ovary using 16666-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 16666-1-AP (GTDC1 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 16666-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GTDC1 antibody (16666-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

GTDC1 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 16666-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

QTMAN, Mat-Xa, mat Xa, Mannosyltransferase-like protein Xa, Glycosyltransferase-like domain-containing protein 1

---

Tested Applications

• Positive IHC detected in: human liver tissue, human kidney tissue, human ovary tissue, human spleen tissue, human testis tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

16666-1-AP targets GTDC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10145

  Product name: Recombinant human GTDC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-292 aa of BC061699

  Sequence: MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNLTELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRDSEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQQRLLHIVWPHRW

• Full Name: glycosyltransferase-like domain containing 1
• Calculated Molecular Weight: 292 aa, 34 kDa, 53 kDa
• GenBank Accession Number: BC061699
• Gene Symbol: GTDC1
• Gene ID (NCBI): 79712
• RRID: AB_1851177
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4AE62
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GTDC1 (glycosyltransferase-like domain containing 1) encodes a putative glycosyltransferase, whose expression is particularly enriched in the nervous system. GTDC1 glycosylation finely tunes a myriad of neural functions, such as neurite outgrowth, axon guidance, synaptogenesis, membrane excitability, neurotransmission, and neuroinflammation (PMID: 38605125).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Sci Rep; A putative UDP-glycosyltransferase from Heterorhabditis bacteriophora suppresses antimicrobial peptide gene expression and factors related to ecdysone signaling.; Authors - Eric Kenney