GTDC1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66578-1-Ig (same clone as 66578-1-PBS)

  Various tissue were subjected to SDS PAGE followed by western blot with 66578-1-Ig (GTDC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66578-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 66578-1-Ig (same clone as 66578-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66578-1-Ig (GTDC1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66578-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 66578-1-Ig (same clone as 66578-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 66578-1-Ig (GTDC1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66578-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 66578-1-Ig (same clone as 66578-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using 66578-1-Ig (GTDC1 antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66578-1-PBS in a different storage buffer formulation.

GTDC1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66578-1-PBS

Clone No.1C4C10

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

GTDC1, mat Xa

---

Product Information

66578-1-PBS targets GTDC1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, pig samples.

• Tested Reactivity: Human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9934

  Product name: Recombinant human GTDC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-292 aa of BC061699

  Sequence: MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNLTELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRDSEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQQRLLHIVWPHRW

• Full Name: glycosyltransferase-like domain containing 1
• Calculated Molecular Weight: 292 aa, 34 kDa, 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC061699
• Gene Symbol: GTDC1
• Gene ID (NCBI): 79712
• RRID: AB_2881938
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q4AE62
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.