Tested Applications
| Positive WB detected in | K-562 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | mouse lung tissue, rat ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10093-2-AP targets GTF2F1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0133 Product name: Recombinant human GTF2F1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 10-215 aa of BC000120 Sequence: NVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLE Predict reactive species |
| Full Name | general transcription factor IIF, polypeptide 1, 74kDa |
| Calculated Molecular Weight | 58 kDa |
| Observed Molecular Weight | 74 kDa |
| GenBank Accession Number | BC000120 |
| Gene Symbol | GTF2F1 |
| Gene ID (NCBI) | 2962 |
| RRID | AB_2114542 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35269 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
In eukaryotic systems, the initiation of gene transcription involves the ordered assembly of a multiprotein complex on proximal promoter elements, consisting of RNA polymerase II and broad families of auxiliary transcription factors. Such factors can be divided into two major functional classes: the basal factors that are required for transcription of all Pol II genes, including TFIIA, B, D, E, F and H; and sequence specific factors that regulate gene expression. The basal transcription factors and Pol II form a specific multiprotein complex near the transcription start site by interacting with core promotor elements such as the TATA box generally located 25-30 base pairs upstream of the transcription start site. TFIIF, a heteromer composed of a small (RAP 30) and a large (RAP 74) subunit, acting at an intermediate stage in initiation complex formation, binds directly to RNA polymerase II in solution and decrease the affinity of RNA polymerase II for nonspecific DNA. In addition, TFIIF stimulates transcription elongation by RNA polymerase II.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GTF2F1 antibody 10093-2-AP | Download protocol |
| IP protocol for GTF2F1 antibody 10093-2-AP | Download protocol |
| WB protocol for GTF2F1 antibody 10093-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GTF2F1 Polyclonal antibody (Cat# 10093-2-AP) has a total of 2 citations. These appear in Science (2023) and Cell Reports (2022). Both studies focus on transcription initiation in eukaryotic cells, specifically examining the structural visualization of transcription initiation and the role of RPAP2 in regulating a transcription initiation checkpoint by inhibiting pre-initiation complex assembly. The research fields are molecular biology and gene transcription regulation, with all citations using the antibody for Western blot in human samples.
| Species | Application | Title |
|---|---|---|
Cell Rep RPAP2 regulates a transcription initiation checkpoint by inhibiting assembly of pre-initiation complex. |











