GTF2F1 Polyclonal antibody

GTF2F1 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 10093-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, IHC, ELISA

BTF4, GTF2F1, RAP74, TF2F1, TFIIF, TFIIF alpha

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells
Positive IP detected inK-562 cells
Positive IHC detected inmouse lung tissue, rat ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

10093-2-AP targets GTF2F1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0133

Product name: Recombinant human GTF2F1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 10-215 aa of BC000120

Sequence: NVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLE

Predict reactive species
Full Name general transcription factor IIF, polypeptide 1, 74kDa
Calculated Molecular Weight 58 kDa
Observed Molecular Weight 74 kDa
GenBank Accession NumberBC000120
Gene Symbol GTF2F1
Gene ID (NCBI) 2962
RRIDAB_2114542
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35269
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In eukaryotic systems, the initiation of gene transcription involves the ordered assembly of a multiprotein complex on proximal promoter elements, consisting of RNA polymerase II and broad families of auxiliary transcription factors. Such factors can be divided into two major functional classes: the basal factors that are required for transcription of all Pol II genes, including TFIIA, B, D, E, F and H; and sequence specific factors that regulate gene expression. The basal transcription factors and Pol II form a specific multiprotein complex near the transcription start site by interacting with core promotor elements such as the TATA box generally located 25-30 base pairs upstream of the transcription start site. TFIIF, a heteromer composed of a small (RAP 30) and a large (RAP 74) subunit, acting at an intermediate stage in initiation complex formation, binds directly to RNA polymerase II in solution and decrease the affinity of RNA polymerase II for nonspecific DNA. In addition, TFIIF stimulates transcription elongation by RNA polymerase II.

Protocols

Product Specific Protocols
WB protocol for GTF2F1 antibody 10093-2-APDownload protocol
IHC protocol for GTF2F1 antibody 10093-2-APDownload protocol
IP protocol for GTF2F1 antibody 10093-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Rep

RPAP2 regulates a transcription initiation checkpoint by inhibiting assembly of pre-initiation complex.

Authors - Xinxin Wang
humanWB

Science

Structural visualization of transcription initiation in action

Authors - Xizi Chen
Loading...
||
New chat Able
正在加载,请稍候...