GTF3C5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GTF3C5 Polyclonal antibody, PBS Only (11447-2-PBS)

• 

  WB analysis of human lung using 11447-2-AP (same clone as 11447-2-PBS)

  human lung tissue were subjected to SDS PAGE followed by western blot with 11447-2-AP (GTF3C5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11447-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 11447-2-AP (same clone as 11447-2-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11447-2-AP (GTF3C5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11447-2-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse lung using 11447-2-AP (same clone as 11447-2-PBS)

  IP result of anti-GTF3C5 (IP:11447-2-AP, 4ug; Detection:11447-2-AP 1:300) with mouse lung tissue lysate 4000 ug. This data was developed using the same antibody clone with 11447-2-PBS in a different storage buffer formulation.

GTF3C5 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 11447-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

11447-2-PBS targets GTF3C5 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1999

  Product name: Recombinant human GTF3C5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC017337

  Sequence: MAAEAADLGLGAAVPVELRRERRMVCVEYPGVVRDVAKMLPTLGGEEGVSRIYADPTKRLELYFRPKDPYCHPVCANRFSTSSLLLRIRKRTRRQKGVLGTEAHSEVTFDMEILGIISTIYKFQGMSDFQYLAVHTEAGGKHTSMYDKVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNPPISGENLIGLSRARRPHNAIFVNFEDEEVPKQPLEAAAQTWRRVCTNPVDRKVEEELRKLFDIRPIWSRNAVKANISVHPDKLKVLLPFIAYYMITGPWRSLWIRFGYDPRKNPDAKIYQVLDFRIRCGMKHGYAPSDLPVKAKRSTYNYSLP

• Full Name: general transcription factor IIIC, polypeptide 5, 63kDa
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC017337
• Gene Symbol: GTF3C5
• Gene ID (NCBI): 9328
• RRID: AB_2115258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5Q8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.