GUCY1B3 Polyclonal antibody

• 

GUCY1B3 Polyclonal Antibody for ELISA

Cat No. 13994-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

GC S beta 1, GC SB3, GCS beta 1, GCS beta 3, GUC1B3, GUCB3, GUCSB3, GUCY1B1, GUCY1B3

---

Product Information

13994-1-AP targets GUCY1B3 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5078

  Product name: Recombinant human GUCY1B3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 282-619 aa of BC047620

  Sequence: EGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETKQDDD

• Full Name: guanylate cyclase 1, soluble, beta 3
• Calculated Molecular Weight: 71 kDa
• GenBank Accession Number: BC047620
• Gene Symbol: GUCY1B3
• Gene ID (NCBI): 2983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02153
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.