Featured Product
KD/KO Validated

GUK1 Monoclonal antibody

GUK1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67047-1-Ig

Clone No. 2H5E1

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

EC:2.7.4.8, GMK, GMP kinase, GMPK, Guanylate kinase

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-P

WB analysis of Jurkat using 67047-1-Ig
Jurkat cells were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 67047-1-Ig
WB result of GUK1 antibody (67047-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GUK1 transfected HEK-293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 67047-1-Ig
WB result of GUK1 antibody (67047-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GUK1 transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 67047-1-Ig
HEK-293 cells were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 67047-1-Ig
Jurkat cells were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of fetal human brain using 67047-1-Ig
fetal human brain tissue were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of rat brain using 67047-1-Ig
rat brain tissue were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse brain using 67047-1-Ig
mouse brain tissue were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human thyroid cancer using 67047-1-Ig
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 67047-1-Ig (GUK1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human prostate cancer using 67047-1-Ig
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67047-1-Ig (GUK1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human thyroid cancer using 67047-1-Ig
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 67047-1-Ig (GUK1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human thyroid cancer using 67047-1-Ig
Immunofluorescent analysis of (4% PFA) fixed human thyroid cancer tissue using GUK1 antibody (67047-1-Ig, Clone: 2H5E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human thyroid cancer using 67047-1-Ig
Immunofluorescent analysis of (4% PFA) fixed human thyroid cancer tissue using GUK1 antibody (67047-1-Ig, Clone: 2H5E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GUK1 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Jurkat cells, HEK-293 cells, fetal human brain tissue, rat brain tissue, mouse brain tissue, HeLa cells
Positive IHC detected in	human thyroid cancer tissue, human prostate cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human thyroid cancer tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:5000
Immunohistochemistry (IHC)	IHC : 1:400-1:1600
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67047-1-Ig targets GUK1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag28805 Product name: Recombinant human GUK1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-197 aa of BC009914 Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA Predict reactive species
Full Name	guanylate kinase 1
Calculated Molecular Weight	22 kDa
Observed Molecular Weight	22-27 kDa
GenBank Accession Number	BC009914
Gene Symbol	GUK1
Gene ID (NCBI)	2987
RRID	AB_2882360
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q16774
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for GUK1 antibody 67047-1-Ig	Download protocol
IHC protocol for GUK1 antibody 67047-1-Ig	Download protocol
WB protocol for GUK1 antibody 67047-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The GUK1 Monoclonal antibody (2H5E1), catalog number 67047-1-Ig, has 1 total citation. It appears in Nature Communications (2025), in a study on targeting spermine metabolism to overcome immunotherapy resistance in pancreatic cancer. The research field encompasses pancreatic oncology, polyamine metabolism, and cancer immunotherapy.