GUK1 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of Jurkat using 67047-1-Ig (same clone as 67047-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67047-1-Ig (same clone as 67047-1-PBS)

  WB result of GUK1 antibody (67047-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GUK1 transfected HEK-293 cells. This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67047-1-Ig (same clone as 67047-1-PBS)

  WB result of GUK1 antibody (67047-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GUK1 transfected HeLa cells. This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67047-1-Ig (same clone as 67047-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67047-1-Ig (same clone as 67047-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 67047-1-Ig (same clone as 67047-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67047-1-Ig (same clone as 67047-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67047-1-Ig (same clone as 67047-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67047-1-Ig (GUK1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 67047-1-Ig (same clone as 67047-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 67047-1-Ig (GUK1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67047-1-Ig (same clone as 67047-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67047-1-Ig (GUK1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 67047-1-Ig (same clone as 67047-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 67047-1-Ig (GUK1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human thyroid cancer using 67047-1-Ig (same clone as 67047-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human thyroid cancer tissue using GUK1 antibody (67047-1-Ig, Clone: 2H5E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human thyroid cancer using 67047-1-Ig (same clone as 67047-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human thyroid cancer tissue using GUK1 antibody (67047-1-Ig, Clone: 2H5E1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67047-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51625-1

  Cytometric bead array sample test of MP51625-1, GUK1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67047-1-PBS. Detection antibody: 67047-2-PBS.

• 

  Cytometric bead array standard curve of MP51625-1

  Cytometric bead array standard curve of MP51625-1, GUK1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67047-1-PBS. Detection antibody: 67047-2-PBS. Standard:Ag28805. Range: 0.781-100 ng/mL.

• Featured Product
• KD/KO Validated

GUK1 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 67047-1-PBS

Clone No.2H5E1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

EC:2.7.4.8, GMK, GMP kinase, GMPK, Guanylate kinase

---

Product Information

67047-1-PBS targets GUK1 as part of a matched antibody pair:

MP51625-1: 67047-1-PBS capture and 67047-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28805

  Product name: Recombinant human GUK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-197 aa of BC009914

  Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA

• Full Name: guanylate kinase 1
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22-27 kDa
• GenBank Accession Number: BC009914
• Gene Symbol: GUK1
• Gene ID (NCBI): 2987
• RRID: AB_2882360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16774
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.