GULP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GULP1 Polyclonal antibody (19902-1-AP)

GULP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19902-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

PTB domain adapter protein CED-6, Protein GULP, GULP, Cell death protein 6 homolog, CED6

• 

  WB analysis using 19902-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19902-1-AP (GULP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 19902-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19902-1-AP (GULP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 19902-1-AP

  Immunohistochemical analysis of paraffin-embedded stomach cancer slide using 19902-1-AP (GULP1 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GULP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells, HepG2 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19902-1-AP targets GULP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13829

  Product name: Recombinant human GULP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-133 aa of BC001103

  Sequence: MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKC

• Full Name: GULP, engulfment adaptor PTB domain containing 1
• Calculated Molecular Weight: 167 aa, 19 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC001103
• Gene Symbol: GULP1
• Gene ID (NCBI): 51454
• RRID: AB_10916254
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBP9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GULP1 Polyclonal antibody (Cat# 19902-1-AP) has 4 citations published in Cardiovascular Diabetology, Cell Death & Disease, International Immunopharmacology, and Aging. The associated research fields include diabetic cardiomyopathy and mitochondrial function, urothelial bladder cancer and lymph node metastasis, osteoarthritis and immunogenic cell death, and chronic obstructive pulmonary disease involving pulmonary macrophage dysfunction.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse, human	WB,IF	Cardiovasc Diabetol; GULP1 protects against diabetic cardiomyopathy through IKIP/NF-κB-dependent improvement of mitochondrial function.; Authors - Meng-Yuan Jiang ; KO Validated
human	WB,IHC	Cell Death Dis; The APC/C E3 ligase subunit ANAPC11 mediates FOXO3 protein degradation to promote cell proliferation and lymph node metastasis in urothelial bladder cancer; Authors - Dong Yan
mouse	WB	Int Immunopharmacol; Calreticulin-driven immunogenic cell death promotes osteoclast differentiation and osteoarthritis progression via the LRP1/Rac1 signaling; Authors - Qi Ma
mouse	WB	Aging (Albany NY); GATA2 downregulation contributes to pro-inflammatory phenotype and defective phagocytosis of pulmonary macrophages in chronic obstructive pulmonary disease; Authors - Shaoran Shen