GULP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GULP1 Polyclonal antibody, PBS Only (19902-1-PBS)

• 

  WB analysis using 19902-1-AP (same clone as 19902-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19902-1-AP (GULP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19902-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 19902-1-AP (same clone as 19902-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19902-1-AP (GULP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19902-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 19902-1-AP (same clone as 19902-1-PBS)

  Immunohistochemical analysis of paraffin-embedded stomach cancer slide using 19902-1-AP (GULP1 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19902-1-PBS in a different storage buffer formulation.

GULP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 19902-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

19902-1-PBS targets GULP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13829

  Product name: Recombinant human GULP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-133 aa of BC001103

  Sequence: MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKC

• Full Name: GULP, engulfment adaptor PTB domain containing 1
• Calculated Molecular Weight: 167 aa, 19 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC001103
• Gene Symbol: GULP1
• Gene ID (NCBI): 51454
• RRID: AB_10916254
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBP9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.