GYG1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GYG1 Polyclonal antibody, PBS Only (12836-1-PBS)

• 

  WB analysis using 12836-1-AP (same clone as 12836-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12836-1-AP (GYG1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12836-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 12836-1-AP (same clone as 12836-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 12836-1-AP (GYG1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 12836-1-AP (same clone as 12836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 12836-1-AP (GYG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 12836-1-AP (same clone as 12836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 12836-1-AP (GYG1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 12836-1-AP (same clone as 12836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 12836-1-AP (GYG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12836-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skeletal muscle using 12836-1-AP (same clone as 12836-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 12836-1-AP (GYG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12836-1-PBS in a different storage buffer formulation.

GYG1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12836-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

EC:2.4.1.186, glycogenin 1, Glycogenin-1, GN1, GN-1

---

Product Information

12836-1-PBS targets GYG1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3583

  Product name: Recombinant human GYG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-331 aa of BC031096

  Sequence: DQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ

• Full Name: glycogenin 1
• Calculated Molecular Weight: 350 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC031096
• Gene Symbol: GYG1
• Gene ID (NCBI): 2992
• RRID: AB_2116101
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46976
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The GYG1 gene encodes glycogenin-1, a core protein in muscle glycogen particles. GYG1 is a glycosyltransferase that forms a short glucose polymer of approximately 10 glucose residues by autoglucosylation (PMID: 25272951 ). Cardiomyopathy and muscle weakness associated with muscle glycogen depletion can also be caused by impaired priming of glycogen synthesis due to inactivation of muscle glycogenin (glycogenin-1) (PMID: 20357282).