CoraLite® Plus 488-conjugated GYPC Polyclonal antibody

GYPC Polyclonal Antibody for IF/ICC

Cat No. CL488-18147

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

CD236, CD236R, GE, GLPC, Glycoconnectin, Glycophorin C, Glycophorin D, Glycoprotein beta, GPC, GPD, GYPC, GYPD, PAS 2, Sialoglycoprotein D

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inK-562 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-18147 targets GYPC in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12825

Product name: Recombinant human GYPC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-128 aa of BC106051

Sequence: MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI

Predict reactive species
Full Name glycophorin C (Gerbich blood group)
Calculated Molecular Weight 128 aa, 14 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC106051
Gene Symbol GYPC
Gene ID (NCBI) 2995
RRIDAB_3672689
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04921
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Glycophorin-C, encoded by the GYPC gene, is a minor sialoglycoprotein in human erythrocyte membranes. Glycophorin-C interacts with protein 4.1R (EPB41) and plays an important role in regulating the mechanical stability of red cells. Glycophorin C acts as the receptor for the Plasmodium falciparum erythrocyte binding ligand PfEBP-2 (baebl). Glycophorin-D, also encoded by the GYPC gene, is now known as a variant of Glycophorin-C. This antibody is raised against the full-length protein of human Glycophorin-C. The apparent molecular weight of Glycophorin-C is larger than the calculated molecular weight due to glycosylation.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GYPC antibody CL488-18147Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...