GYS2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85122-4-RR (same clone as 85122-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85122-4-RR (GYS2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85122-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 85122-4-RR (same clone as 85122-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide (positive control) and mouse skeletal muscle tissue slide (Negative control) using 85122-4-RR (GYS2 antibody) at dilution of 1:50000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85122-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85122-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85122-4-RR against Human GYS2 were performed. The affinity constant is 3.11 nM.

GYS2 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85122-4-PBS

Clone No.242595F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242595F10, EC:2.4.1.11, Glycogen synthase 2, glycogen synthase 2 (liver)

---

Product Information

85122-4-PBS targets GYS2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18012

  Product name: Recombinant human GYS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 604-703 aa of BC126310

  Sequence: YYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN

• Full Name: glycogen synthase 2 (liver)
• Calculated Molecular Weight: 703 aa, 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC126310
• Gene Symbol: GYS2
• Gene ID (NCBI): 2998
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P54840
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GYS2 (Glycogen Synthase 2) is a key enzyme involved in the synthesis of glycogen in the liver. It catalyzes the addition of glucose molecules to the growing glycogen chain, playing a crucial role in maintaining glucose homeostasis. GYS2 is essential for liver glycogen synthesis, which acts as a critical energy reserve for maintaining blood glucose levels, especially during fasting or prolonged exercise. Impairment of GYS2 function can lead to glycogen storage disease type 0 (GSD-0), characterized by hypoglycemia and liver glycogen deficiency. The GYS2 is highest expressed in the liver, and its expression in liver was significantly higher than other tissues. (PMID:39150597; PMID:37574425)