GYS2 Recombinant monoclonal antibody, PBS Only

GYS2 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 85122-4-PBS
Clone No.242595F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

242595F10, EC:2.4.1.11, Glycogen synthase 2, glycogen synthase 2 (liver)

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85122-4-PBS targets GYS2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18012

Product name: Recombinant human GYS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 604-703 aa of BC126310

Sequence: YYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN

Predict reactive species
Full Name glycogen synthase 2 (liver)
Calculated Molecular Weight 703 aa, 81 kDa
Observed Molecular Weight 81 kDa
GenBank Accession NumberBC126310
Gene Symbol GYS2
Gene ID (NCBI) 2998
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54840
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GYS2 (Glycogen Synthase 2) is a key enzyme involved in the synthesis of glycogen in the liver. It catalyzes the addition of glucose molecules to the growing glycogen chain, playing a crucial role in maintaining glucose homeostasis. GYS2 is essential for liver glycogen synthesis, which acts as a critical energy reserve for maintaining blood glucose levels, especially during fasting or prolonged exercise. Impairment of GYS2 function can lead to glycogen storage disease type 0 (GSD-0), characterized by hypoglycemia and liver glycogen deficiency. The GYS2 is highest expressed in the liver, and its expression in liver was significantly higher than other tissues. (PMID:39150597; PMID:37574425)

Loading...
||
New chat Able
正在加载,请稍候...