Granzyme B Polyclonal antibody

Granzyme B Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 31521-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

GZMB, Cathepsin G-like 1, CCPI, CGL 1, CGL1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNK-92 cells, U-937 cells
Positive IHC detected inhuman lymphoma tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inNK-92 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31521-1-AP targets Granzyme B in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg0592

Product name: Recombinant Human Granzyme B protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*HIS

Domain: 19-247 aa of BC030195

Sequence: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Predict reactive species
Full Name granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
Calculated Molecular Weight 247 aa, 28 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC030195
Gene Symbol Granzyme B
Gene ID (NCBI) 3002
RRIDAB_3670018
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP10144
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GZMB(Granzyme B) is also named as CGL1, CSPB, CTLA1, GRB and belongs to the Granzyme subfamily. This enzyme is necessary for target cell lysis in cell-mediated immune responses. The cytotoxic lymphocyte protease granzyme B (GzmB) can promote apoptosis through direct processing and activation of members of the caspase family. GzmB can also cleave the BH3-only protein, BID, to promote caspase-independent mitochondrial permeabilization (PMID:17283187). GzmB induces laminB degradation in isolated nuclei less efficiently than GzmA (PMID:11331782). This full length protein has 2 glycosylation sites and a signal peptide. Unglycosylated human granzyme B is 26 kDa and high mannose glycosylated is 32 kDa and only 32kDa or smaller forms of granzyme B are accumulated within nuclei (PMID:8626751). GzmB also forms dimers.

Protocols

Product Specific Protocols
IHC protocol for Granzyme B antibody 31521-1-APDownload protocol
WB protocol for Granzyme B antibody 31521-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...