CoraLite® Plus 647-conjugated Galectin-3 Monoclonal antibody

• 

  IF Staining of HeLa using CL647-60207

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 647 Galectin-3 antibody (CL647-60207, Clone: 1C1B2 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL647-60207

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 647 Anti-Human Galectin-3 (CL647-60207, Clone:1C1B2) (red), or 0.8 ug CoraLite® Plus 647 Mouse IgG2b Isotype Control (MPC-11) (CL647-65128, Clone: MPC-11) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

Galectin-3 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL647-60207

Clone No.1C1B2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

Gal 3, CBP35, CBP 35, Carbohydrate-binding protein 35, 35 kDa lectin

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-60207 targets Galectin-3 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6753

  Product name: Recombinant human Galectin 3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-250 aa of BC001120

  Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

• Full Name: lectin, galactoside-binding, soluble, 3
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC001120
• Gene Symbol: Galectin-3
• Gene ID (NCBI): 3958
• RRID: AB_2934983
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P17931
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).