Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Galectin-3 Monoclonal antibody

Galectin-3 Monoclonal Antibody for IF/ICC, IF-P, FC (Intra)

Cat No. CL594-60207
Clone No.1C1B2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC, IF-P, FC (Intra)

1C1B2, 35 kDa lectin, Carbohydrate-binding protein 35, CBP 35, CBP35

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman thyroid cancer tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60207 targets Galectin-3 in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6753

Product name: Recombinant human Galectin 3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-250 aa of BC001120

Sequence: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

Predict reactive species
Full Name lectin, galactoside-binding, soluble, 3
Calculated Molecular Weight 26 kDa
GenBank Accession NumberBC001120
Gene Symbol Galectin-3
Gene ID (NCBI) 3958
RRIDAB_2883441
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP17931
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-3, a member of the β-galactoside-binding proteins, contains one carbohydrate recognition domain (CRD) and a proline- and glycine-rich N-terminal domain through which is able to form oligomers (PMID: 14758078). Galectin-3 is widely expressed in many normal tissues and a variety of tumors. It is found intracellularly in nucleus and cytoplasm or secreted outside of cell, being present on the cell surface or in the extracellular space (PMID: 16478649). Galectin-3 is involved in various biological processes including cell growth, adhesion, differentiation, apoptosis, angiogenesis, immune response, neoplastic transformation and metastasis (PMID: 16478649; 14758078).

Protocols

Product Specific Protocols
FC protocol for CL594 Galectin-3 antibody CL594-60207Download protocol
IF protocol for CL594 Galectin-3 antibody CL594-60207Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIF

Reproduction

Postcopulatory transcriptional profiling of the murine uterotubal junction identifies potential sperm selection mediators.

Authors - Nikola Arsić
Loading...
||
New chat

Able

正在加载,请稍候...