Galectin-7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Galectin-7 Polyclonal antibody, PBS Only (16730-1-PBS)

• 

  WB analysis of mouse skin using 16730-1-AP (same clone as 16730-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 16730-1-AP (Galectin-7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16730-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse small intestine using 16730-1-AP (same clone as 16730-1-PBS)

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 16730-1-AP (Galectin-7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervix using 16730-1-AP (same clone as 16730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervix using 16730-1-AP (Galectin-7 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 16730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervix using 16730-1-AP (same clone as 16730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervix using 16730-1-AP (Galectin-7 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 16730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 16730-1-AP (same clone as 16730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 16730-1-AP (Galectin-7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 16730-1-AP (same clone as 16730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 16730-1-AP (Galectin-7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16730-1-PBS in a different storage buffer formulation.

Galectin-7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16730-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

LGALS7B, Gal 7, GAL7, Gal-7, Galectin 7

---

Product Information

16730-1-PBS targets Galectin-7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10188

  Product name: Recombinant human Galectin-7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC073743

  Sequence: MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

• Full Name: lectin, galactoside-binding, soluble, 7B
• Calculated Molecular Weight: 136 aa, 15 kDa
• Observed Molecular Weight: 14-15 kDa
• GenBank Accession Number: BC073743
• Gene Symbol: Galectin-7
• Gene ID (NCBI): 653499
• RRID: AB_10596781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47929
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Galectins are a family of animal lectins defined by shared characteristic amino-acid sequences and affinity for β-galactose-containing oligosac-charides (PMID: 8063692). Galectin-7 contains one carbohydrate recognition domain (CRD) and is biologically active as monomer. It is mainly expressed in stratified epithelium, especially in epidermis. Alterations of galectin-7 expression during cancer progression have been reported. Galectin-7 is involved in epithelial differentiation and development and may have a role in tumour development (PMID: 16429325).