CoraLite® Plus 488-conjugated Geminin Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-10802

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 Geminin antibody (CL488-10802) at dilution of 1:200.

• Featured Product
• KD/KO Validated

Geminin Polyclonal Antibody for IF/ICC

Cat No. CL488-10802

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Gem, Geminin, GMNN, RP3 369A17.3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10802 targets Geminin in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1076

  Product name: Recombinant human GMNN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-209 aa of BC005185

  Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

• Full Name: geminin, DNA replication inhibitor
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 28-29 kDa
• GenBank Accession Number: BC005185
• Gene Symbol: GMNN
• Gene ID (NCBI): 51053
• RRID: AB_2918997
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75496
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in ininhibiting DNA replication by preventing the incorporation of MCM complex into pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to apparent mass of 42.5 kDa and 66 kDa are present. (PMID: 15313623)