CoraLite®594-conjugated Geminin Recombinant monoclonal antibody

Geminin Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL594-84199-2
Clone No.240835B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

GMNN, 240835B5, Gem, MGORS6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-84199-2 targets Geminin in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1076

Product name: Recombinant human GMNN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-209 aa of BC005185

Sequence: MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

Predict reactive species
Full Name geminin, DNA replication inhibitor
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 28-29 kDa
GenBank Accession NumberBC005185
Gene Symbol GMNN
Gene ID (NCBI) 51053
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75496
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GMNN, also designated geminin, contains 212 amino acids and has a destruction box sequence (RRTLKVIQP). GMNN participates in inhibiting DNA replication by preventing the incorporation of MCM complex into the pre-replication complex (pre-RC). It is degraded during the metaphase-anaphase transition of cell cycle's mitotic phase, which permits replication in the succeeding cell cycle. GMNN has a broad sedimentation profile ranging from about 25 kDa to 90 kDa, with a major peak at 30 kDa. Scanning of the signals shows that discrete peaks corresponding to the apparent mass of 42.5 kDa and 66 kDa are present. The dimer of geminin(50 kDa) can also be detected. (PMID: 15313623)

Protocols

Product Specific Protocols
IF protocol for CL594 Geminin antibody CL594-84199-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...