CoraLite® Plus 488-conjugated Glucocorticoid receptor Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-82619-4

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 Glucocorticoid receptor antibody (CL488-82619-4, Clone: 2F22 ) at dilution of 1:200.

• 

  IF Staining of HepG2 using CL488-82619-4

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 Glucocorticoid receptor antibody (CL488-82619-4, Clone: 2F22 ) at dilution of 1:200, CL594-phalloidin (red).

Glucocorticoid receptor Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82619-4

Clone No.2F22

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

IF/ICC

Synonyms

GCCR, GCR, Glucocorticoid receptor, GR, GRL, NR3C1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82619-4 targets Glucocorticoid receptor in IF/ICC applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag21146

  Product name: Recombinant human Glucocorticoid receptor protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC015610

  Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI

• Full Name: nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 94-97 kDa
• GenBank Accession Number: BC015610
• Gene Symbol: Glucocorticoid receptor
• Gene ID (NCBI): 2908
• RRID: AB_3084516
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04150
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058).