Glutamate receptor 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Glutamate receptor 2 Polyclonal antibody, PBS Only (11994-1-PBS)

• 

  WB analysis using 11994-1-AP (same clone as 11994-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11994-1-AP (Glutamate receptor 2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11994-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 11994-1-AP (same clone as 11994-1-PBS)

  IP result of anti-Glutamate receptor 2 (IP:11994-1-AP, 4ug; Detection:11994-1-AP 1:2000) with mouse brain tissue lysate 2100 ug. This data was developed using the same antibody clone with 11994-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11994-1-AP (same clone as 11994-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11994-1-AP (Glutamate receptor 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11994-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 11994-1-AP (same clone as 11994-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse eye tissue using Glutamate receptor 2 antibody (11994-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11994-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 11994-1-AP (same clone as 11994-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Glutamate receptor 2 antibody (11994-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11994-1-PBS in a different storage buffer formulation.

Glutamate receptor 2 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 11994-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

GRIA2, AMPA-selective glutamate receptor 2, GluA2, GluR 2, GluR B

---

Product Information

11994-1-PBS targets Glutamate receptor 2 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2662

  Product name: Recombinant human GRIA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-356 aa of BC010574

  Sequence: GADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLVEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGL

• Full Name: glutamate receptor, ionotropic, AMPA 2
• Calculated Molecular Weight: 883 aa, 99 kDa
• Observed Molecular Weight: 94-105 kDa
• GenBank Accession Number: BC010574
• Gene Symbol: GRIA2
• Gene ID (NCBI): 2891
• RRID: AB_2113725
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42262
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA2 (glutamate receptor 2, GluR-2) belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels that mediate the fast component of excitatory postsynaptic currents in neurons of the central nervous system. These channels are assembled from 4 related subunits, GRIA1-4. The presence of GRIA2 in the heteromeric AMPA receptors impermeabilizes it to calcium, preventing possible calcium-mediated toxicity.