Glutamine Synthetase Polyclonal antibody, PBS Only

Name: Glutamine Synthetase Polyclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 11037-2-PBS-100UG

Glutamine Synthetase Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA

Cat No. 11037-2-PBS

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

Synonyms

GLUL, EC:2.3.1.225, EC:6.3.1.2, GLNS, Glutamate--ammonia ligase

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF-PFC (Intra)

WB analysis of Jurkat using 11037-2-AP (same clone as 11037-2-PBS)
WB result of Glutamine synthetase antibody (11037-2-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Glutamine synthetase transfected Jurkat cells. This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 11037-2-AP (same clone as 11037-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 11037-2-AP (Glutamine Synthetase antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 11037-2-AP (same clone as 11037-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 11037-2-AP (Glutamine Synthetase antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse liver using 11037-2-AP (same clone as 11037-2-PBS)
IP result of anti-Glutamine Synthetase (IP:11037-2-AP, 4ug; Detection:11037-2-AP 1:5000) with mouse liver tissue lysate 2400 ug. This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 11037-2-AP (same clone as 11037-2-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11037-2-AP (Glutamine Synthetase antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 11037-2-AP (same clone as 11037-2-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 11037-2-AP (Glutamine Synthetase antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse liver using 11037-2-AP (same clone as 11037-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse liver tissue using Glutamine Synthetase antibody (11037-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse eye using 11037-2-AP (same clone as 11037-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Glutamine Synthetase antibody (11037-2-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse liver using 11037-2-AP (same clone as 11037-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using Glutamine Synthetase antibody (11037-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Beta Catenin antibody (66379-1-Ig, Clone: 1B8A1, Magenta). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using Glutamine Synthetase antibody (11037-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Beta Catenin antibody (66379-1-Ig, Clone: 1B8A1, Magenta). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
IF Staining of human brain using 11037-2-AP (same clone as 11037-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed human brain tissue using 11037-2-AP (Glutamine synthetase antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of Jurkat using 11037-2-AP (same clone as 11037-2-PBS)
1x10^6 Jurkat cells were intracellularly stained with 0.4 ug Glutamine Synthetase Polyclonal antibody (11037-2-AP)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HepG2 using 11037-2-AP (same clone as 11037-2-PBS)
1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Glutamine Synthetase Polyclonal antibody (11037-2-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Glutamine Synthetase Polyclonal antibody (11037-2-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 11037-2-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for Glutamine Synthetase in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11037-2-PBS targets Glutamine Synthetase in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1510 Product name: Recombinant human Glutamine synthetase protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-373 aa of BC011700 Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN Predict reactive species
Full Name	glutamate-ammonia ligase (glutamine synthetase)
Calculated Molecular Weight	374 aa, 42 kDa
Observed Molecular Weight	40-42 kDa
GenBank Accession Number	BC011700
Gene Symbol	Glutamine Synthetase
Gene ID (NCBI)	2752
RRID	AB_2110650
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P15104
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

GLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family.This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts(PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759).