Glutamine Synthetase Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Glutamine Synthetase Monoclonal antibody (66323-2-Ig)

• Featured Product
• KD/KO Validated

Glutamine Synthetase Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

Cat No. 66323-2-Ig Copied!

Clone No. 1B6G4

Publications (8)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

Synonyms

GLUL, 1B6G4, EC:2.3.1.225, EC:6.3.1.2, GLNS

• 

  WB analysis of Jurkat using 66323-2-Ig

  WB result of Glutamine synthetase antibody (66323-2-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Glutamine synthetase transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 66323-2-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse liver using 66323-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse liver tissue using Glutamine Synthetase antibody (66323-2-Ig, Clone: 1B6G4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 66323-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Glutamine Synthetase antibody (66323-2-Ig, Clone: 1B6G4 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 66323-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Glutamine Synthetase antibody (66323-2-Ig, Clone: 1B6G4 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse liver using 66323-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse liver tissue using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 66323-2-Ig

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human Glutamine Synthetase (66323-2-Ig, Clone:1B6G4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Glutamine Synthetase in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human liver cancer tissue, human liver tissue, rat liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse liver tissue, mouse brain tissue
• Positive IF-Fro detected in: mouse liver tissue
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66323-2-Ig targets Glutamine Synthetase in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat, canine
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6309

  Product name: Recombinant human Glutamine synthetase protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-373 aa of BC011700

  Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

• Full Name: glutamate-ammonia ligase (glutamine synthetase)
• Calculated Molecular Weight: 374 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC011700
• Gene Symbol: Glutamine Synthetase
• Gene ID (NCBI): 2752
• RRID: AB_2881704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15104
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Glutamine Synthetase Monoclonal antibody (1B6G4), catalog number 66323-2-Ig, has 11 total citations. These appear in journals including Bone Research, Advanced Science, Neural Regeneration Research, Cancer Medicine, Disease Markers, Journal of Advanced Research, and Journal of Hazardous Materials. Associated research fields span intervertebral disc degeneration, glioma progression, retinal injury and degeneration, hepatocellular carcinoma, diabetic cardiac neuropathy, depression, and visual toxicity.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Bone Res; Chaperone-mediated autophagy directs a dual mechanism to balance premature senescence and senolysis to prevent intervertebral disc degeneration; Authors - Zhangrong Cheng
human		Adv Sci (Weinh); GLUL Confers Perivascular Cancer-Associated Fibroblasts With Pro-Angiogenic Capacity to Promote Glioma Progression.; Authors - Qing Zhang ; KD Validated
rat	IF	Neural Regen Res; Müller cells are activated in response to retinal outer nuclear layer degeneration in rats subjected to simulated weightlessness conditions; Authors - Yuxue Mu
canine	IF	Neural Regen Res; Necroptosis plays a crucial role in the exacerbation of retinal injury after blunt ocular trauma; Authors - Yu Huan
human	IHC	Cancer Med; Differences in Tumor-Infiltrating Lymphocyte Counts in the Peritumoral Area in Patients Undergoing Hepatic Resection After Lenvatinib and Atezolizumab Plus Bevacizumab Therapy for Hepatocellular Carcinoma; Authors - Katsuya Toshida
rat	IF	Dis Markers; Schisandrin B Alleviates Diabetic Cardiac Autonomic neuropathy Induced by P2X7 Receptor in Superior Cervical Ganglion via NLRP3.; Authors - Zhihua Zhang