CoraLite® Plus 647-conjugated Glutamine Synthetase Monoclonal antibody

• 

  IF Staining of mouse brain using CL647-66323-2

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 647 Glutamine Synthetase antibody (CL647-66323-2, Clone: 1B6G4 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using CL647-66323-2

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 647 Glutamine Synthetase antibody (CL647-66323-2, Clone: 1B6G4 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

Glutamine Synthetase Monoclonal Antibody for IF-P

Cat No. CL647-66323-2

Clone No.1B6G4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

GLUL, Glutamate--ammonia ligase, GLNS, EC:6.3.1.2, EC:2.3.1.225

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66323-2 targets Glutamine Synthetase in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6309

  Product name: Recombinant human Glutamine synthetase protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-373 aa of BC011700

  Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

• Full Name: glutamate-ammonia ligase (glutamine synthetase)
• Calculated Molecular Weight: 374 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC011700
• Gene Symbol: Glutamine Synthetase
• Gene ID (NCBI): 2752
• RRID: AB_3084821
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15104
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.