• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Glutamine Synthetase Monoclonal antibody

Glutamine Synthetase Monoclonal Antibody for IF-P
Cat No. CL488-66323-2
Clone No.1B6G4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF-P

GLUL, 1B6G4, EC:2.3.1.225, EC:6.3.1.2, GLNS

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66323-2 targets Glutamine Synthetase in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6309

Product name: Recombinant human Glutamine synthetase protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-373 aa of BC011700

Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

Predict reactive species
Full Name glutamate-ammonia ligase (glutamine synthetase)
Calculated Molecular Weight 374 aa, 42 kDa
Observed Molecular Weight42 kDa
GenBank Accession NumberBC011700
Gene Symbol Glutamine Synthetase
Gene ID (NCBI) 2752
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP15104
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family.This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts (PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Glutamine Synthetase antibody CL488-66323-2Download protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jaide (Verified Customer) (10-02-2025)

Before the rebatch of this product it worked great for our panels (CL488-66323). After it was rebatched (without any notice to us until we were told after placing an order), it has not worked the same. We are noticing inconsistent results with staining and non-specific binding. The rebatch seems to have interference with our treatment that the original product didn't have, or was minimal.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse Liver/ Central Veins
FH

Jaide (Verified Customer) (04-07-2025)

Only GLUL antibody I have test that is specific to central veins in mouse liver. It created clear precise staining that is easy to optimize.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Mouse Liver/ Central Veins
Loading...
||
New chat

Able

正在加载,请稍候...