Glutamine Synthetase Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of Jurkat using 66323-2-Ig (same clone as 66323-2-PBS)

  WB result of Glutamine synthetase antibody (66323-2-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Glutamine synthetase transfected Jurkat cells. This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:4000 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse liver tissue using Glutamine Synthetase antibody (66323-2-Ig, Clone: 1B6G4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Glutamine Synthetase antibody (66323-2-Ig, Clone: 1B6G4 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Glutamine Synthetase antibody (66323-2-Ig, Clone: 1B6G4 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 66323-2-Ig (same clone as 66323-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse liver tissue using 66323-2-Ig (Glutamine Synthetase antibody) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66323-2-Ig (same clone as 66323-2-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human Glutamine Synthetase (66323-2-Ig, Clone:1B6G4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66323-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50483-1

  Cytometric bead array standard curve of MP50483-1, Glutamine synthetase Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66323-2-PBS. Detection antibody: 66323-1-PBS. Standard:Ag6309. Range: 3.125-100 ng/mL.

• Featured Product
• KD/KO Validated

Glutamine Synthetase Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 66323-2-PBS

Clone No.1B6G4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

GLUL, 1B6G4, EC:2.3.1.225, EC:6.3.1.2, GLNS

---

Product Information

66323-2-PBS targets Glutamine Synthetase as part of a matched antibody pair:

MP50483-1: 66323-2-PBS capture and 66323-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6309

  Product name: Recombinant human Glutamine synthetase protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-373 aa of BC011700

  Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN

• Full Name: glutamate-ammonia ligase (glutamine synthetase)
• Calculated Molecular Weight: 374 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC011700
• Gene Symbol: Glutamine Synthetase
• Gene ID (NCBI): 2752
• RRID: AB_2881704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P15104
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.