GlyT2 Polyclonal antibody

• 

  WB analysis using 25948-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25948-1-AP (GlyT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 25948-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 25948-1-AP (GlyT2 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 25948-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using GlyT2 antibody (25948-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse brain using 25948-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using GlyT2 antibody (25948-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

GlyT2 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 25948-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

SLC6A5, Sodium- and chloride-dependent glycine transporter 2, NET1, GlyT-2, GlyT 2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25948-1-AP targets GlyT2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22835

  Product name: Recombinant human SLC6A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC096319

  Sequence: MDCSAPKEMNKLPANSPEAAAAQGHPDGPCAPRTSPEQELPAAAAPPPPRVPRSASTGAQTFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPSLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLGTDGITSVLPGSVATVATQEDEQGDENKARGNWSSKLDF

• Full Name: solute carrier family 6 (neurotransmitter transporter, glycine), member 5
• Calculated Molecular Weight: 797 aa, 87 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC096319
• Gene Symbol: GlyT2
• Gene ID (NCBI): 9152
• RRID: AB_3085831
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y345
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GlyT2 is a transporter protein of the SLC6 family of sodium- and chloride-dependent neurotransmitter transporters. Like other members of the family, GlyT2 is trafficked to the cell surface as homo-oligomers from the endoplasmic reticulum (ER) (PMID: 32714574). GlyT2 is expressed in medulla, and to a lesser extent in spinal cord and cerebellum. GlyT2 has 3 isoforms with the molecular mass of 63, 86 and 87 kDa. The 63 kDa band is the unglycosylated GlyT2 polypeptide, whereas the 70-110 kDa band is a differential glycosylation form of GlyT2 (PMID: 17851090, 17962467).