Glycophorin A/CD235a Monoclonal antibody, PBS Only (Detector)

Glycophorin A/CD235a Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 66778-1-PBS
Clone No.2B12G10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Glycophorin A, 2B12G10, CD235a, Glycophorin-A, GPA

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66778-1-PBS targets Glycophorin A/CD235a as part of a matched antibody pair:

MP50422-2: 66778-2-PBS capture and 66778-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8635

Product name: Recombinant human GYPA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-150 aa of BC005319

Sequence: EVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ

Predict reactive species
Full Name glycophorin A (MNS blood group)
Calculated Molecular Weight 150 aa, 16 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC005319
Gene Symbol Glycophorin A
Gene ID (NCBI) 2993
RRIDAB_2882124
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02724
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702)

Loading...
||
New chat Able
正在加载,请稍候...