Glypican-5 Polyclonal antibody

• 

  WB analysis using 30999-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30999-1-AP (GPC5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

Glypican-5 Polyclonal Antibody for WB, ELISA

Cat No. 30999-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

GPC5, Secreted glypican-5, glypican 5

---

Tested Applications

• Positive WB detected in: HeLa cells, NCI-H1299 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30999-1-AP targets Glypican-5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34039

  Product name: Recombinant human GPC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-225 aa of BC039730

  Sequence: EGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQVCISKKPTCCTRKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAASVQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRDVSPFGNIPQRVMGQMGRSLLPSRTF

• Full Name: glypican 5
• Calculated Molecular Weight: 572 aa, 64 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC039730
• Gene Symbol: Glypican 5
• Gene ID (NCBI): 2262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P78333
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glypican-5 (GPC5), which is predicted to be located in the cell membrane. In adult, primarily expressed in the brain. Also detected in fetal brain, lung and liver (PMID: 9070915). Glypican-5 is a member of heparan sulfate proteoglycans. The repressive role of GPC5 intumorigenesis has been reported in a variety of cancers, including rhabdomyosarcoma, breast cancer, and prostate cancer. GPC5, which is lowly expressed in lung cancer tissues compared with adjacent noncancerous tissues, exhibits a suppressive effect on migration and invasion, and it can also induce G1/S phase arrest of the lung cancer cells in vitro, which is associated with a better prognosis (PMID: 34079082). The molecular weight of Glypican-5 is 63 kDa.