• Featured Product
  • KD/KO Validated

Biotin-conjugated Progranulin/PGRN Polyclonal antibody

Progranulin/PGRN Polyclonal Antibody for IHC
Cat No. Biotin-18410

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

granulin, Epithelin precursor, Glycoprotein 88, Glycoprotein of 88 Kda, Granulin precursor

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  Biotin
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-18410 targets Progranulin/PGRN in IHC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13178

Product name: Recombinant human PCDGF,GRN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-363 aa of BC000324

Sequence: MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRD

Predict reactive species
Full Name granulin
Calculated Molecular Weight 64 kDa
GenBank Accession NumberBC000324
Gene Symbol Granulin
Gene ID (NCBI) 2896
RRIDAB_2883060
Conjugate Biotin
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP28799
Storage Buffer PBS with 50% Glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GRN, also known as PGRN or PCDGF, is a cysteine-rich protein of 68.5 kDa that is typically secreted into a highly glycosylated 88 kDa form. PGRN is a unique growth factor that plays an important role in cutaneous wound healing. It has an anti-inflammatory effect and promotes cell proliferation. When PCDGF is degraded to several 6-25 kDa fragments, called granulins (GRNs) by neutrophil proteases, a pro-inflammatory reaction occurs. PGRN is widely expressed, particularly in epithelial cells, immune cells, neurons, and chondrocytes. High levels of PGRN expression have been reported in human cancers, and its expression is closely correlated with the development and metastasis of several cancers. The recent discovery that mutations in the gene encoding for pro-granulin (GRN) cause frontotemporal lobar degeneration (FTLD), and other neurodegenerative diseases leading to dementia, has brought renewed interest in progranulin and its functions in the central nervous system. This antibody is conjugated with Biotin.

Protocols

Product Specific Protocols
IHC protocol for Biotin Progranulin/PGRN antibody Biotin-18410Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...