CoraLite® Plus 488-conjugated Granzyme A Recombinant monoclonal antibody

Granzyme A Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84583-3
Clone No.241979B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

GrA, GZMA, 241979B8, CTL tryptase, CTLA3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84583-3 targets Granzyme A in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1818

Product name: Recombinant human GZMA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-262 aa of BC015739

Sequence: MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV

Predict reactive species
Full Name granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
Calculated Molecular Weight 29 kDa
GenBank Accession NumberBC015739
Gene Symbol Granzyme A
Gene ID (NCBI) 3001
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP12544
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Granzyme A(GrA, a tryptase) is necessary for target cell lysis in cell-mediated immune responses. It activates mitochondrial outer membrane permeabilization- and caspase-independent cell death pathways by cleaving the mitochondrial complex I component NDUFS3after lys56. Among serine proteases GrA has an unique quaternary structure consisting of a disulphide-linked homodimer of 60kDa linked via Cys93.(PMID: 12819769) This protein has 2 isoforms produced by alternative promoter usage with the MW of 29 and 27 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Granzyme A antibody CL488-84583-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...