Anti-Human Granzyme B Rabbit Recombinant Antibody, PBS Only

Granzyme B Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98070-1-PBS
Clone No.240761G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

GZMB, 240761G4, Cathepsin G-like 1, CCPI, CGL 1

Formulation:  PBS Only
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

98070-1-PBS targets Granzyme B in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0592

Product name: Recombinant Human Granzyme B protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*HIS

Domain: 19-247 aa of BC030195

Sequence: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Predict reactive species
Full Name granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
Calculated Molecular Weight 247 aa, 28 kDa
GenBank Accession NumberBC030195
Gene Symbol Granzyme B
Gene ID (NCBI) 3002
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP10144
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GZMB (Granzyme B) is also named as CGL1, CSPB, CTLA1, GRB and belongs to the Granzyme subfamily. This enzyme is necessary for target cell lysis in cell-mediated immune responses. The cytotoxic lymphocyte protease granzyme B (GzmB) can promote apoptosis through direct processing and activation of members of the caspase family. GzmB can also cleave the BH3-only protein, BID, to promote caspase-independent mitochondrial permeabilization (PMID:17283187). GzmB induces lamin B degradation in isolated nuclei less efficiently than GzmA (PMID:11331782). This full-length protein has 2 glycosylation sites and a signal peptide. Unglycosylated human granzyme B is 26 kDa and high mannose glycosylated is 32 kDa and only 32 kDa or smaller forms of granzyme B are accumulated within nuclei (PMID:8626751). GzmB also forms dimers.

Loading...
||
New chat Able
正在加载,请稍候...