Anti-Human Granzyme B Rabbit Recombinant Antibody

Granzyme B Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98070-1-RR
Clone No.240761G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

GZMB, 240761G4, Cathepsin G-like 1, CCPI, CGL 1

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98070-1-RR targets Granzyme B in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0592

Product name: Recombinant Human Granzyme B protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*HIS

Domain: 19-247 aa of BC030195

Sequence: GEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Predict reactive species
Full Name granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1)
Calculated Molecular Weight 247 aa, 28 kDa
GenBank Accession NumberBC030195
Gene Symbol Granzyme B
Gene ID (NCBI) 3002
RRIDAB_3672217
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP10144
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

GZMB (Granzyme B) is also named as CGL1, CSPB, CTLA1, GRB and belongs to the Granzyme subfamily. This enzyme is necessary for target cell lysis in cell-mediated immune responses. The cytotoxic lymphocyte protease granzyme B (GzmB) can promote apoptosis through direct processing and activation of members of the caspase family. GzmB can also cleave the BH3-only protein, BID, to promote caspase-independent mitochondrial permeabilization (PMID:17283187). GzmB induces lamin B degradation in isolated nuclei less efficiently than GzmA (PMID:11331782). This full-length protein has 2 glycosylation sites and a signal peptide. Unglycosylated human granzyme B is 26 kDa and high mannose glycosylated is 32 kDa and only 32 kDa or smaller forms of granzyme B are accumulated within nuclei (PMID:8626751). GzmB also forms dimers.

Protocols

Product Specific Protocols
FC protocol for Granzyme B antibody 98070-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...