GSDMD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSDMD Polyclonal antibody (30695-1-AP)

• KD/KO Validated

GSDMD Polyclonal Antibody for WB, IP, ELISA

Cat No. 30695-1-AP

Publications(24)

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IF, IP, ELISA

Synonyms

AW558049, DF5L, Dfna5l, gasdermin D, Gasdermin domain-containing protein 1

• 

  WB analysis of RAW 264.7 using 30695-1-AP

  WB result of GSDMD antibody (30695-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSDMD transfected RAW 264.7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30695-1-AP (Gsdmd antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30695-1-AP (Gsdmd antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 30695-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 30695-1-AP (Gsdmd antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of RAW 264.7 using 30695-1-AP

  IP result of anti-Gsdmd (IP:30695-1-AP, 4ug; Detection:30695-1-AP 1:4000) with RAW 264.7 cells lysate 1400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: EL-4 cells, EL-4-B5 cells, NIH/3T3 cells, RAW 264.7 cells, mouse liver tissue
• Positive IP detected in: RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30695-1-AP targets GSDMD in WB, IF, IP, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33609

  Product name: Recombinant mouse Gsdmd protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 199-487 aa of BC029813

  Sequence: GHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC*

• Full Name: gasdermin D
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 50-53 kDa, 43 kDa
• GenBank Accession Number: BC029813
• Gene Symbol: Gsdmd
• Gene ID (NCBI): 69146
• RRID: AB_3086391
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9D8T2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSDMD is a 53 kDa cytosolic protein and a member of the gasdermin protein family, which features 6 members in humans (GSDMA, -B, -C, -D, -E and -F. GSDMD was identified as the executioner of inflammasome-associated pyroptosis. Caspase-1, -11, or -4 cleave GSDMD after an aspartate residue within a central linker domain (D275 in humans and D276 in mice) to generate a 31-kDa N-terminal GSDMD fragment (GSDMD-NT) and a 22-kDa C-terminal fragment (GSDMD-CT). In addition to the canonical 31/22 kDa cleavage products, a 43 kDa fragment has been observed under specific experimental or pathological conditions. The generation of the 43 kDa fragment was observed upon caspase-3 and -7 activation during apoptosis. This antibody can detect 53 kDa full-length GSDMD and 43 kDa fragment as described in the literature (PMID: 28392147, PMID: 28979266).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Immunol Lett; NETs activate AIM2 to mediate synovial fibroblast pyroptosis and promote acute gouty arthritis development; Authors - Jing Tian
mouse	WB,IF	Chem Biol Interact; Decabromodiphenyl ether (BDE-209) induces learning and memory impairment via JAK2/STAT3/NLRP3 axis-mediated pyroptosis and neuroinflammation.; Authors - Liujiangshan Jiang
mouse	WB	Front Cell Dev Biol; Gypensapogenin I alleviates PANoptosis, ferroptosis, and oxidative stress in myocardial ischemic-reperfusion injury by targeting the NOX2/AMPK pathway.; Authors - Yuqiong Chen
mouse	WB	Nan Fang Yi Ke Da Xue Xue Bao; [Morinda officinalis polysaccharide delays osteoarthritis mouse chondrocyte degeneration by modulating the glycolysis-pyroptosis axis via targeting the lncRNA XIST].; Authors - 付长龙
mouse	WB	J Transl Med; Integration of angiogenesis and programmed cell death mechanisms unveils potential diagnostic and therapeutic targets in spinal cord injury.; Authors - Feng Lu
human, mouse	WB	J Adv Res; Ginsenoside Rh1 ameliorates polystyrene nanoplastics-caused vascular injury by regulating HSP70 to suppress endoplasmic reticulum stress and pyroptosis.; Authors - Yue-qin Song