GSDMD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GSDMD Polyclonal antibody (30695-1-AP)

• KD/KO Validated

GSDMD Polyclonal Antibody for WB, IP, ELISA

Cat No. 30695-1-AP Copied!

Publications (24)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (1)

Applications

WB, IF, IP, ELISA

Synonyms

AW558049, DF5L, Dfna5l, gasdermin D, Gasdermin domain-containing protein 1

• 

  WB analysis of RAW 264.7 using 30695-1-AP

  WB result of GSDMD antibody (30695-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GSDMD transfected RAW 264.7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30695-1-AP (Gsdmd antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30695-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30695-1-AP (Gsdmd antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 30695-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 30695-1-AP (Gsdmd antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of RAW 264.7 using 30695-1-AP

  IP result of anti-Gsdmd (IP:30695-1-AP, 4ug; Detection:30695-1-AP 1:4000) with RAW 264.7 cells lysate 1400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GSDMD in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: EL-4 cells, EL-4-B5 cells, NIH/3T3 cells, RAW 264.7 cells, mouse liver tissue
• Positive IP detected in: RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30695-1-AP targets GSDMD in WB, IF, IP, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33609

  Product name: Recombinant mouse Gsdmd protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 199-487 aa of BC029813

  Sequence: GHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC*

• Full Name: gasdermin D
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 50-53 kDa, 43 kDa
• GenBank Accession Number: BC029813
• Gene Symbol: Gsdmd
• Gene ID (NCBI): 69146
• RRID: AB_3086391
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9D8T2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSDMD is a 53 kDa cytosolic protein and a member of the gasdermin protein family, which features 6 members in humans (GSDMA, -B, -C, -D, -E and -F. GSDMD was identified as the executioner of inflammasome-associated pyroptosis. Caspase-1, -11, or -4 cleave GSDMD after an aspartate residue within a central linker domain (D275 in humans and D276 in mice) to generate a 31-kDa N-terminal GSDMD fragment (GSDMD-NT) and a 22-kDa C-terminal fragment (GSDMD-CT). In addition to the canonical 31/22 kDa cleavage products, a 43 kDa fragment has been observed under specific experimental or pathological conditions. The generation of the 43 kDa fragment was observed upon caspase-3 and -7 activation during apoptosis. This antibody can detect 53 kDa full-length GSDMD and 43 kDa fragment as described in the literature (PMID: 28392147, PMID: 28979266).

Publications

What published studies show

The GSDMD Polyclonal antibody (Cat# 30695-1-AP) has 24 citations spanning 23 journals, including J Adv Res, Redox Biology, Biomaterials, Journal of Controlled Release, ACS Applied Materials & Interfaces, and Frontiers in Immunology. Research fields predominantly cover pyroptosis, NLRP3 inflammasome activation, PANoptosis, neuroinflammation, cancer immunotherapy, osteoarthritis, ischemic stroke, atherosclerosis, and myocardial injury. Applications cited include WB and IF in mouse and human models.

Automatically generated from the 24 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	WB	J Adv Res; Ginsenoside Rh1 ameliorates polystyrene nanoplastics-caused vascular injury by regulating HSP70 to suppress endoplasmic reticulum stress and pyroptosis.; Authors - Yue-qin Song
mouse	IF	Redox Biol; PHGDH-dependent serine metabolism in astrocytes: A key regulator of oxidative stress and pyroptosis in cerebral ischemia-reperfusion injury.; Authors - Jimeng Zhang
mouse	WB	J Nanobiotechnology; HIFU postoperative hypoxia-activated metal-organic frameworks modulate the tumor microenvironment to augment immunotherapy.; Authors - Chengyan Luo
mouse	WB,IF	J Nanobiotechnology; An injectable dihydroartemisinin nanocomposite hydrogel for dual-targeting PANoptosis and inflammation to treat osteoarthritis.; Authors - Qingchen Li
mouse	WB	Biomaterials; A novel nano-biocomposite synergistically activates PANoptosis and cGAS-STING for precise cancer immunotherapy.; Authors - Guoqing Zhu
mouse	WB	J Control Release; Dual-targeted nano-inhibitors of pyroptosis for synergistic therapy of traumatic brain injury.; Authors - Zhao Wang