Mouse GSDMD Recombinant monoclonal antibody, PBS Only (Detector)

GSDMD Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83562-3-PBS
Clone No.240548B10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

240548B10, AW558049, DF5L, Dfna5l, gasdermin D

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83562-3-PBS targets GSDMD as part of a matched antibody pair:

MP00534-2: 83562-2-PBS capture and 83562-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34905

Product name: Recombinant mouse Gsdmd protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 199-487 aa of BC029813

Sequence: GHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC*

Predict reactive species
Full Name gasdermin D
Calculated Molecular Weight53 kDa
Observed Molecular Weight53 kDa
GenBank Accession NumberBC029813
Gene Symbol Gsdmd
Gene ID (NCBI) 69146
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9D8T2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GSDMD is a 53 kDa cytosolic protein and a member of the gasdermin protein family, which features 6 members in humans (GSDMA, -B, -C, -D, -E and -F. GSDMD was identified as the executioner of inflammasome-associated pyroptosis. Caspase-1, -11, or -4 cleave GSDMD after an aspartate residue within a central linker domain (D275 in humans and D276 in mice) to generate a 31-kDa N-terminal GSDMD fragment (GSDMD-NT) and a 22-kDa C-terminal fragment (GSDMD-CT). In addition to the canonical 31/22 kDa cleavage products, a 43 kDa fragment has been observed under specific experimental or pathological conditions. The generation of the 43 kDa fragment was observed upon caspase-3 and -7 activation during apoptosis. This antibody can only detect full-length GSDMD.

Loading...
||
New chat Able
正在加载,请稍候...