Mouse GSDMD Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of NIH/3T3 using 83562-3-RR (same clone as 83562-3-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 83562-3-RR (Gsdmd antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83562-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 83562-3-RR (same clone as 83562-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83562-3-RR (Gsdmd antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83562-3-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP00534-2

  J774A.1 call lysate was measured.The mouse Gsdmd concentration of detected samples was determined to be 21.0 ng/mL, based on a 3.4 mg/mL lysate load.

• 

  Sandwich ELISA standard curve of MP00534-2

  Sandwich ELISA standard curve of MP00534-2, Mouse Gsdmd Recombinant Matched Antibody Pair - PBS only. 83562-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag34905. 83562-3-PBS was HRP conjugated as the detection antibody. Range: 0.16-10 ng/mL

• 

  IF Staining of NIH/3T3 using 83562-3-RR (same clone as 83562-3-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using Gsdmd antibody (83562-3-RR, Clone: 240548B10 ) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 83562-3-PBS in a different storage buffer formulation.

• 

  FC experiment of RAW 264.7 using 83562-3-RR (same clone as 83562-3-PBS)

  1x10^6 RAW 264.7 cells were intracellularly stained with 0.25 ug Gsdmd Recombinant antibody (83562-3-RR, Clone:240548B10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83562-3-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00534-2

  Cytometric bead array standard curve of MP00534-2, MOUSE GSDMD Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83562-2-PBS. Detection antibody: 83562-3-PBS. Standard: Ag34905. Range: 0.625-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 83562-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83562-3-RR against Mouse Gsdmd were performed. The affinity constant is 1.19 nM.

GSDMD Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 83562-3-PBS

Clone No.240548B10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

240548B10, AW558049, DF5L, Dfna5l, gasdermin D

---

Product Information

83562-3-PBS targets GSDMD as part of a matched antibody pair:

MP00534-2: 83562-2-PBS capture and 83562-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34905

  Product name: Recombinant mouse Gsdmd protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 199-487 aa of BC029813

  Sequence: GHQSRKKMVTIPAGSILAFRVAQLLIGSKWDILLVSDEKQRTFEPSSGDRKAVGQRHHGLNVLAALCSIGKQLSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQKPC*

• Full Name: gasdermin D
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC029813
• Gene Symbol: Gsdmd
• Gene ID (NCBI): 69146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9D8T2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GSDMD is a 53 kDa cytosolic protein and a member of the gasdermin protein family, which features 6 members in humans (GSDMA, -B, -C, -D, -E and -F. GSDMD was identified as the executioner of inflammasome-associated pyroptosis. Caspase-1, -11, or -4 cleave GSDMD after an aspartate residue within a central linker domain (D275 in humans and D276 in mice) to generate a 31-kDa N-terminal GSDMD fragment (GSDMD-NT) and a 22-kDa C-terminal fragment (GSDMD-CT). In addition to the canonical 31/22 kDa cleavage products, a 43 kDa fragment has been observed under specific experimental or pathological conditions. The generation of the 43 kDa fragment was observed upon caspase-3 and -7 activation during apoptosis. This antibody can only detect full-length GSDMD.