CoraLite® Plus 488-conjugated SPINT1/HAI-1 Monoclonal antibody

SPINT1/HAI-1 Monoclonal Antibody for IF/ICC
Cat No. CL488-67031
Clone No.2H2D8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

HAI 1, HAI-1, SPINT1, 2H2D8, HAI

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67031 targets SPINT1/HAI-1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26733

Product name: Recombinant human SPINT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 307-441 aa of BC004140

Sequence: SMERRHPVCSGTCQPTQFRCSNGCCIDSFLECDDTPNCPDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIP

Predict reactive species
Full Name serine peptidase inhibitor, Kunitz type 1
Calculated Molecular Weight 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC004140
Gene Symbol HAI-1
Gene ID (NCBI) 6692
RRIDAB_3672936
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43278
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Hepatocyte growth factor activator inhibitor type 1 (HAI-1) is also named as SPINT1 and Kunitz-type protease inhibitor 1. HAI-1 is critical to control matriptase proteolytic activity (PMID: 25310042). HAI-1 inhibits matriptase activity through forming complex with activated matriptase (PMID: 30370662). matriptase, HAI‐1 also binds to and inhibits a variety of serine proteases including of hepsin, plasmin, prostasin, TMPRSS13 and HAT. HAI-1 as a cell-autonomous tumor suppressor that negatively regulates the HGF pathway (PMID: 25925948). HAI-1 is inhibitor of HGFAC (PMID: 9045658). HAI-1 inhibits serine protease activity of ST14/matriptase in vitro (PMID: 28710277). HAI-1 inhibits serine protease activity of TMPRSS13, via the BPTI/Kunitz inhibitor 1 domain (PMID: 20977675). HAI-1 expression is reduced in many cancer types, which is implicated in the progression of cancer and is associated with a worse prognosis in cancer patients (PMID: 30370662).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SPINT1/HAI-1 antibody CL488-67031Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...