HAPLN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• HAPLN2 Polyclonal antibody, PBS Only (27818-1-PBS)

• 

  WB analysis of pig brain using 27818-1-AP (same clone as 27818-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 27818-1-AP (HAPLN2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27818-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 27818-1-AP (same clone as 27818-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 27818-1-AP (HAPLN2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27818-1-PBS in a different storage buffer formulation.

HAPLN2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27818-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, pig

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

27818-1-PBS targets HAPLN2 in WB, Indirect ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27169

  Product name: Recombinant human HAPLN2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-120 aa of BC029864

  Sequence: MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRL

• Full Name: hyaluronan and proteoglycan link protein 2
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC029864
• Gene Symbol: HAPLN2
• Gene ID (NCBI): 60484
• RRID: AB_2880982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZV7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.